TMEM163 antibody (Middle Region)

Catalog No. ABIN634949

Product Details anti-TMEM163 Antibody

Target: TMEM163 (Transmembrane Protein 163 (TMEM163))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM163 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM163 antibody was raised against the middle region of TMEM163

Purification: Affinity purified

Immunogen: TMEM163 antibody was raised using the middle region of TMEM163 corresponding to a region with amino acids AAVHSAHREYIACVILGVIFLLSSICIVVKAIHDLSTRLLPEVDDFLFSV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM163 Blocking Peptide, catalog no. 33R-1058, is also available for use as a blocking control in assays to test for specificity of this TMEM163 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM163 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM163

Target: TMEM163 (Transmembrane Protein 163 (TMEM163))

Alternative Name: TMEM163 (TMEM163 Products)

Background: The function of TMEM163 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 31 kDa (MW of target protein)