PAQR6 antibody (N-Term)

Catalog No. ABIN634948

Product Details anti-PAQR6 Antibody

Target: PAQR6 (Progestin and AdipoQ Receptor Family Member VI (PAQR6))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PAQR6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PAQR6 antibody was raised against the N terminal of PAQR6

Purification: Affinity purified

Immunogen: PAQR6 antibody was raised using the N terminal of PAQR6 corresponding to a region with amino acids PGLSKVLRTGAFAYPFLFDNLPLFYRLGLCWGRGHGCGQEALSTSHGYHL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PAQR6 Blocking Peptide, catalog no. 33R-7117, is also available for use as a blocking control in assays to test for specificity of this PAQR6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAQR6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PAQR6

Target: PAQR6 (Progestin and AdipoQ Receptor Family Member VI (PAQR6))

Alternative Name: PAQR6 (PAQR6 Products)

Synonyms: MGC115032 antibody, paqr6 antibody, 1500001B10Rik antibody, putative progestin and adipoq receptor family member VI antibody, progestin and adipoQ receptor family member VI L homeolog antibody, progestin and adipoQ receptor family member VI antibody, progestin and adipoQ receptor family member VI S homeolog antibody, progestin and adipoQ receptor family member 6 antibody, Smp_086190 antibody, paqr6.L antibody, paqr6 antibody, paqr6.S antibody, PAQR6 antibody, Paqr6 antibody

Background: This protein mediates receptor activity.

Molecular Weight: 39 kDa (MW of target protein)