POPDC3 antibody (C-Term)

Catalog No. ABIN634947

Product Details anti-POPDC3 Antibody

Target: POPDC3 (Popeye Domain Containing 3 (POPDC3))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POPDC3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: POPDC3 antibody was raised against the C terminal of POPDC3

Purification: Affinity purified

Immunogen: POPDC3 antibody was raised using the C terminal of POPDC3 corresponding to a region with amino acids YLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKRYHYDIRLPNFYQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POPDC3 Blocking Peptide, catalog no. 33R-10174, is also available for use as a blocking control in assays to test for specificity of this POPDC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POPDC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for POPDC3

Target: POPDC3 (Popeye Domain Containing 3 (POPDC3))

Alternative Name: POPDC3 (POPDC3 Products)

Synonyms: pop3 antibody, POP1 antibody, POP3 antibody, RP11-99L11.2 antibody, bA355M14.1 antibody, AA682104 antibody, Pop3 antibody, popeye domain containing 3 antibody, POPDC3 antibody, popdc3 antibody, Popdc3 antibody

Background: POPDC3 is a member of the POP family of proteins containing three putative transmembrane domains. The protein is expressed in cardiac and skeletal muscle and may play an important role in these tissues during development.

Molecular Weight: 34 kDa (MW of target protein)