TMEM30A antibody (N-Term)

Catalog No. ABIN634944

Product Details anti-TMEM30A Antibody

Target: TMEM30A (Transmembrane Protein 30A (TMEM30A))

Binding Specificity: N-Term

Reactivity: Mouse, Rat, Human, Zebrafish (Danio rerio), Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM30A antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: TMEM30 A antibody was raised against the N terminal of TMEM30

Purification: Affinity purified

Immunogen: TMEM30 A antibody was raised using the N terminal of TMEM30 corresponding to a region with amino acids FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM30A Blocking Peptide, catalog no. 33R-3094, is also available for use as a blocking control in assays to test for specificity of this TMEM30A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM30A

Target: TMEM30A (Transmembrane Protein 30A (TMEM30A))

Alternative Name: TMEM30A (TMEM30A Products)

Synonyms: tmem30a antibody, wu:fj66b08 antibody, zgc:91877 antibody, fi23a10 antibody, wu:fb15c10 antibody, wu:fi23a10 antibody, zgc:55379 antibody, zgc:77655 antibody, cg9947 antibody, MGC53259 antibody, MGC75889 antibody, CDC50A antibody, DKFZp459A091 antibody, DKFZp459D097 antibody, DKFZp459B0431 antibody, C6orf67 antibody, 2010200I23Rik antibody, AW540225 antibody, Cdc50a antibody, D9Wsu20e antibody, transmembrane protein 30Aa antibody, transmembrane protein 30A antibody, transmembrane protein 30Ab antibody, transmembrane protein 30A L homeolog antibody, tmem30aa antibody, TMEM30A antibody, tmem30ab antibody, tmem30a.L antibody, tmem30a antibody, LOAG_03933 antibody, Tmem30a antibody

Background: The function of TMEM30A protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 41 kDa (MW of target protein)