IMPAD1 antibody (N-Term)

Catalog No. ABIN634943

Product Details anti-IMPAD1 Antibody

Target: IMPAD1 (Inositol Monophosphatase Domain Containing 1 (IMPAD1))

Binding Specificity: N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IMPAD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IMPAD1 antibody was raised against the N terminal of IMPAD1

Purification: Affinity purified

Immunogen: IMPAD1 antibody was raised using the N terminal of IMPAD1 corresponding to a region with amino acids VLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IMPAD1 Blocking Peptide, catalog no. 33R-9642, is also available for use as a blocking control in assays to test for specificity of this IMPAD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPAD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IMPAD1

Target: IMPAD1 (Inositol Monophosphatase Domain Containing 1 (IMPAD1))

Alternative Name: IMPAD1 (IMPAD1 Products)

Synonyms: IMP 3 antibody, RGD1306455 antibody, gPAPP antibody, impa3 antibody, 1110001C20Rik antibody, AA408880 antibody, AI451589 antibody, AL022796 antibody, B230207P20 antibody, Jaws antibody, GPAPP antibody, IMP-3 antibody, IMPA3 antibody, IMPase 3 antibody, zgc:123256 antibody, inositol monophosphatase domain containing 1 antibody, inositol monophosphatase domain containing 1 S homeolog antibody, Impad1 antibody, impad1.S antibody, IMPAD1 antibody, impad1 antibody

Background: The function of IMPAD protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process