POMT2 antibody (Middle Region)

Catalog No. ABIN634940

Product Details anti-POMT2 Antibody

Target: POMT2 (Protein-O-Mannosyltransferase 2 (POMT2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POMT2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: POMT2 antibody was raised against the middle region of POMT2

Purification: Affinity purified

Immunogen: POMT2 antibody was raised using the middle region of POMT2 corresponding to a region with amino acids RKHYQVTGYGINGTGDSNDFWRIEVVNRKFGNRIKVLRSRIRFIHLVTGC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POMT2 Blocking Peptide, catalog no. 33R-7995, is also available for use as a blocking control in assays to test for specificity of this POMT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POMT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for POMT2

Target: POMT2 (Protein-O-Mannosyltransferase 2 (POMT2))

Alternative Name: POMT2 (POMT2 Products)

Synonyms: CG12311 antibody, DPOMT2 antibody, DmPOMT2 antibody, Dmel\\CG12311 antibody, EG:34F3.7 antibody, POMT2 antibody, Pomt2 antibody, dPOMT2 antibody, im:7153045 antibody, zPOMT2 antibody, zgc:158749 antibody, LGMD2N antibody, MDDGA2 antibody, MDDGB2 antibody, MDDGC2 antibody, A830009D15Rik antibody, AW046274 antibody, twisted antibody, protein O-mannosyltransferase 2 antibody, protein-O-mannosyltransferase 2 antibody, tw antibody, POMT2 antibody, pomt2 antibody, Pomt2 antibody

Background: POMT2 encodes an integral membrane protein of the endoplasmic reticulum (ER) that shares significant sequence similarity with a family of protein O-mannosyltransferases of S.cerevisiae.

Molecular Weight: 84 kDa (MW of target protein)