SPATA9 antibody (N-Term)

Catalog No. ABIN634932

Product Details anti-SPATA9 Antibody

Target: SPATA9 (Spermatogenesis Associated 9 (SPATA9))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SPATA9 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SPATA9 antibody was raised against the N terminal of SPATA9

Purification: Affinity purified

Immunogen: SPATA9 antibody was raised using the N terminal of SPATA9 corresponding to a region with amino acids PIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SPATA9 Blocking Peptide, catalog no. 33R-7156, is also available for use as a blocking control in assays to test for specificity of this SPATA9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SPATA9

Target: SPATA9 (Spermatogenesis Associated 9 (SPATA9))

Alternative Name: SPATA9 (SPATA9 Products)

Synonyms: SPATA9 antibody, NYD-SP16 antibody, 1700030K01Rik antibody, 4930599C08Rik antibody, A930023H06Rik antibody, spermatogenesis associated 9 antibody, SPATA9 antibody, Spata9 antibody

Background: SPATA9 may play a role in testicular development/spermatogenesis and may be an important factor in male infertility. Defects in expression of SPATA9 lead to Sertoli-cell-only syndrome.

Molecular Weight: 29 kDa (MW of target protein)