MMP23B antibody (N-Term)
-
- Target See all MMP23B Antibodies
- MMP23B (Matrix Metallopeptidase 23B (MMP23B))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MMP23B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MMP23 B antibody was raised against the N terminal of MMP23
- Purification
- Affinity purified
- Immunogen
- MMP23 B antibody was raised using the N terminal of MMP23 corresponding to a region with amino acids ILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYP
- Top Product
- Discover our top product MMP23B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MMP23B Blocking Peptide, catalog no. 33R-4060, is also available for use as a blocking control in assays to test for specificity of this MMP23B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP20 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MMP23B (Matrix Metallopeptidase 23B (MMP23B))
- Alternative Name
- MMP23B (MMP23B Products)
- Background
- MMP23B is a member of the matrix metalloproteinase (MMP) family, and it is part of a duplicated region of chromosome 1p36.3. Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis.
- Molecular Weight
- 36 kDa (MW of target protein)
-