Kallikrein 5 antibody (N-Term)

Catalog No. ABIN634928

Product Details anti-Kallikrein 5 Antibody

Target: Kallikrein 5 (KLK5)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Kallikrein 5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KLK5 antibody was raised against the N terminal of KLK5

Purification: Affinity purified

Immunogen: KLK5 antibody was raised using the N terminal of KLK5 corresponding to a region with amino acids CDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLK5 Blocking Peptide, catalog no. 33R-1662, is also available for use as a blocking control in assays to test for specificity of this KLK5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLK5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Kallikrein 5

Target: Kallikrein 5 (KLK5)

Alternative Name: KLK5 (KLK5 Products)

Synonyms: KLK-L2 antibody, KLKL2 antibody, SCTE antibody, 1110030O19Rik antibody, KAL antibody, KALA antibody, Klk1 antibody, Klk5 antibody, RATKALA antibody, kallikrein related peptidase 5 antibody, kallikrein related-peptidase 5 antibody, kallikrein 5-like antibody, KLK5 antibody, Klk5 antibody, Klk5l antibody

Background: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Complement System, Regulation of G-Protein Coupled Receptor Protein Signaling