FAM20C antibody (C-Term)

Catalog No. ABIN634926

Product Details anti-FAM20C Antibody

Target: FAM20C (Family with Sequence Similarity 20, Member C (FAM20C))

Binding Specificity: C-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM20C antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM20 C antibody was raised against the C terminal of FAM20

Purification: Affinity purified

Immunogen: FAM20 C antibody was raised using the C terminal of FAM20 corresponding to a region with amino acids NETFIIHLDNGRGFGKYSHDELSILVPLQQCCRIRKSTYLRLQLLAKEEY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM20C Blocking Peptide, catalog no. 33R-6677, is also available for use as a blocking control in assays to test for specificity of this FAM20C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM20C

Target: FAM20C (Family with Sequence Similarity 20, Member C (FAM20C))

Alternative Name: FAM20C (FAM20C Products)

Synonyms: DMP-4 antibody, DMP4 antibody, GEF-CK antibody, RNS antibody, C76981 antibody, mKIAA4081 antibody, RGD1311980 antibody, si:ch73-266a4.1 antibody, FAM20C, golgi associated secretory pathway kinase antibody, family with sequence similarity 20, member C antibody, family with sequence similarity 20, member Cb antibody, FAM20C antibody, Fam20c antibody, fam20cb antibody

Background: FAM20C belongs to the FAM20 family. FAM20C is a calcium-binding protein which may play a role in dentin mineralization. Mutations in FAM20C are associated with lethal osteosclerotic bone dysplasia (Raine Syndrome), highlighting a crucial molecule in bone development.

Molecular Weight: 66 kDa (MW of target protein)