FAM20C antibody (Middle Region)
-
- Target See all FAM20C Antibodies
- FAM20C (Family with Sequence Similarity 20, Member C (FAM20C))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FAM20C antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FAM20 C antibody was raised against the middle region of FAM20
- Purification
- Affinity purified
- Immunogen
- FAM20 C antibody was raised using the middle region of FAM20 corresponding to a region with amino acids CFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSY
- Top Product
- Discover our top product FAM20C Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FAM20C Blocking Peptide, catalog no. 33R-1689, is also available for use as a blocking control in assays to test for specificity of this FAM20C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM20 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM20C (Family with Sequence Similarity 20, Member C (FAM20C))
- Alternative Name
- FAM20C (FAM20C Products)
- Synonyms
- DMP-4 antibody, DMP4 antibody, GEF-CK antibody, RNS antibody, C76981 antibody, mKIAA4081 antibody, RGD1311980 antibody, si:ch73-266a4.1 antibody, FAM20C, golgi associated secretory pathway kinase antibody, family with sequence similarity 20, member C antibody, family with sequence similarity 20, member Cb antibody, FAM20C antibody, Fam20c antibody, fam20cb antibody
- Background
- FAM20C belongs to the FAM20 family. FAM20C is a calcium-binding protein which may play a role in dentin mineralization. Mutations in FAM20C are associated with lethal osteosclerotic bone dysplasia (Raine Syndrome), highlighting a crucial molecule in bone development.
- Molecular Weight
- 66 kDa (MW of target protein)
-