TRIM59 antibody (N-Term)

Catalog No. ABIN634923

Product Details anti-TRIM59 Antibody

Target: TRIM59 (Tripartite Motif Containing 59 (TRIM59))

Binding Specificity: N-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRIM59 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRIM59 antibody was raised against the N terminal of TRIM59

Purification: Affinity purified

Immunogen: TRIM59 antibody was raised using the N terminal of TRIM59 corresponding to a region with amino acids RIPLKCPNCRSITEIAPTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRIM59 Blocking Peptide, catalog no. 33R-7974, is also available for use as a blocking control in assays to test for specificity of this TRIM59 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM59 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRIM59

Target: TRIM59 (Tripartite Motif Containing 59 (TRIM59))

Alternative Name: TRIM59 (TRIM59 Products)

Synonyms: zgc:193694 antibody, zgc:193700 antibody, TRIM59 antibody, MRF1 antibody, RNF104 antibody, TRIM57 antibody, TSBF1 antibody, 2310035M22Rik antibody, 2700022F13Rik antibody, Mrf1 antibody, RGD1311956 antibody, LYR motif containing 9 antibody, tripartite motif containing 59 antibody, tripartite motif-containing 59 antibody, lyrm9 antibody, TRIM59 antibody, Trim59 antibody

Background: The function of TRIM59 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 44 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome