Surfeit 4 antibody (N-Term)

Catalog No. ABIN634922

Product Details anti-Surfeit 4 Antibody

Target: Surfeit 4 (SURF4)

Binding Specificity: N-Term

Reactivity: Mouse, Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Surfeit 4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SURF4 antibody was raised against the N terminal of SURF4

Purification: Affinity purified

Immunogen: SURF4 antibody was raised using the N terminal of SURF4 corresponding to a region with amino acids GQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SURF4 Blocking Peptide, catalog no. 33R-3504, is also available for use as a blocking control in assays to test for specificity of this SURF4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SURF4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Surfeit 4

Target: Surfeit 4 (SURF4)

Alternative Name: SURF4 (SURF4 Products)

Synonyms: CG6202 antibody, Dmel\\CG6202 antibody, SURF-4 antibody, Surf-4 antibody, SURF4 antibody, MGC88894 antibody, GB14656 antibody, Surf4 antibody, DKFZp459A164 antibody, ERV29 antibody, erv29 antibody, surf4 antibody, zgc:65806 antibody, zgc:77007 antibody, AL033340 antibody, AL033373 antibody, Surfeit 4 antibody, surfeit 4 antibody, surfeit 4, gene 1 antibody, surfeit locus protein 4 homolog antibody, surfeit 4, gene 1 L homeolog antibody, surfeit gene 4 antibody, Surf4 antibody, SURF4 antibody, surf4.1 antibody, LOC552234 antibody, surf4.1.L antibody, surf4 antibody

Background: SURF4 is a conserved integral membrane protein containing multiple putative transmembrane regions. In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). The specific function of this protein has not been determined but its yeast homolog is directly required for packaging glycosylated pro-alpha-factor into COPII vesicles.

Molecular Weight: 30 kDa (MW of target protein)