Metaxin 1 antibody (C-Term)

Catalog No. ABIN634920

Product Details anti-Metaxin 1 Antibody

Target: Metaxin 1 (MTX1)

Binding Specificity: C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Metaxin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Metaxin 1 antibody was raised against the C terminal of MTX1

Purification: Affinity purified

Immunogen: Metaxin 1 antibody was raised using the C terminal of MTX1 corresponding to a region with amino acids CLTLLSQRLGSQKFFFGDAPASLDAFVFSYLALLLQAKLPSGKLQVHLRG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Metaxin 1 Blocking Peptide, catalog no. 33R-1748, is also available for use as a blocking control in assays to test for specificity of this Metaxin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Metaxin 1

Target: Metaxin 1 (MTX1)

Alternative Name: Metaxin 1 (MTX1 Products)

Synonyms: MTX antibody, MTXN antibody, Gcap6 antibody, Mtx antibody, mtx1 antibody, zgc:101675 antibody, Metaxin-1 antibody, metaxin 1 antibody, metaxin 1b antibody, Metaxin 1 antibody, metaxin 1 S homeolog antibody, metaxin 1 (predicted) antibody, metaxin-1 antibody, MTX1 antibody, Mtx1 antibody, mtx1b antibody, mtx1.S antibody, mtx1 antibody, SPAC589.04 antibody, LOC100587360 antibody

Background: MTX1 belongs to the metaxin family. It is involved in transport of proteins into the mitochondrion and essential for embryonic development.

Molecular Weight: 51 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport