CLDND1 antibody (Middle Region)

Catalog No. ABIN634913

Product Details anti-CLDND1 Antibody

Target: CLDND1 (Claudin Domain Containing 1 (CLDND1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CLDND1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Claudin Domain Containing 1 antibody was raised against the middle region of CLDND1

Purification: Affinity purified

Immunogen: Claudin Domain Containing 1 antibody was raised using the middle region of CLDND1 corresponding to a region with amino acids TLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Claudin Domain Containing 1 Blocking Peptide, catalog no. 33R-9186, is also available for use as a blocking control in assays to test for specificity of this Claudin Domain Containing 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDND1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CLDND1

Target: CLDND1 (Claudin Domain Containing 1 (CLDND1))

Alternative Name: Claudin Domain Containing 1 (CLDND1 Products)

Synonyms: MGC53751 antibody, LOC100217896 antibody, 1110019C08Rik antibody, AA407103 antibody, AI849195 antibody, AW489850 antibody, Cldnd1 antibody, C3orf4 antibody, GENX-3745 antibody, claudin domain containing 1 L homeolog antibody, claudin domain containing 1 antibody, cldnd1.L antibody, cldnd1 antibody, CLDND1 antibody, Cldnd1 antibody

Background: CLDND1 belongs to the PMP-22/EMP/MP20 family. The exact function of CLDND1 remains unknown.

Molecular Weight: 28 kDa (MW of target protein)