LST-3TM12 antibody (Middle Region)

Catalog No. ABIN634912

Product Details anti-LST-3TM12 Antibody

Target: LST-3TM12 (Organic Anion Transporter LST-3b (LST-3TM12))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LST-3TM12 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LST-3 TM12 antibody was raised against the middle region of LST-3 M12

Purification: Affinity purified

Immunogen: LST-3 TM12 antibody was raised using the middle region of LST-3 M12 corresponding to a region with amino acids LKTNDKRNQIANLTNRRKYITKNVTGFFQSLKSILTNPLYVIFVIFTLLH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LST-3TM12 Blocking Peptide, catalog no. 33R-5109, is also available for use as a blocking control in assays to test for specificity of this LST-3TM12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LST-0 M12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LST-3TM12

Target: LST-3TM12 (Organic Anion Transporter LST-3b (LST-3TM12))

Alternative Name: LST-3TM12 (LST-3TM12 Products)

Synonyms: LST-3 antibody, LST-3TM12 antibody, LST3 antibody, SLC21A21 antibody, solute carrier organic anion transporter family member 1B7 (putative) antibody, SLCO1B7 antibody

Background: The function of LST-3TM12 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 71 kDa (MW of target protein)