Tricellulin antibody (Middle Region)
-
- Target See all Tricellulin (MARVELD2) Antibodies
- Tricellulin (MARVELD2)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Tricellulin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MARVELD2 antibody was raised against the middle region of MARVELD2
- Purification
- Affinity purified
- Immunogen
- MARVELD2 antibody was raised using the middle region of MARVELD2 corresponding to a region with amino acids PKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVAL
- Top Product
- Discover our top product MARVELD2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MARVELD2 Blocking Peptide, catalog no. 33R-7179, is also available for use as a blocking control in assays to test for specificity of this MARVELD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MARVELD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Tricellulin (MARVELD2)
- Alternative Name
- MARVELD2 (MARVELD2 Products)
- Synonyms
- Mrvldc2 antibody, BC003296 antibody, MARVD2 antibody, Tric antibody, Trica antibody, Tricb antibody, Tricc antibody, DFNB49 antibody, MRVLDC2 antibody, MARVEL domain containing 2 antibody, MARVEL (membrane-associating) domain containing 2 antibody, Marveld2 antibody, MARVELD2 antibody
- Background
- Tight junctions (TJ) prevent leakage of solutes through the paracellular pathway of epithelial cells. MARVELD2, or tricellulin (TRIC), is an integral membrane protein concentrated at the vertically oriented TJ strands of tricellular contacts.
- Molecular Weight
- 52 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound, Cell-Cell Junction Organization
-