LFNG antibody (N-Term)
-
- Target See all LFNG Antibodies
- LFNG (LFNG O-Fucosylpeptide 3-beta-N-Acetylglucosaminyltransferase (LFNG))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LFNG antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LFNG antibody was raised against the N terminal of LFNG
- Purification
- Affinity purified
- Immunogen
- LFNG antibody was raised using the N terminal of LFNG corresponding to a region with amino acids LSEYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVKTTK
- Top Product
- Discover our top product LFNG Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LFNG Blocking Peptide, catalog no. 33R-5423, is also available for use as a blocking control in assays to test for specificity of this LFNG antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LFNG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LFNG (LFNG O-Fucosylpeptide 3-beta-N-Acetylglucosaminyltransferase (LFNG))
- Alternative Name
- LFNG (LFNG Products)
- Background
- LFNG is a member of the glycosyltransferase superfamily. It is a single-pass type II Golgi membrane protein that functions as a fucose-specific glycosyltransferase, adding an N-acetylglucosamine to the fucose residue of a group of signaling receptors involved in regulating cell fate decisions during development. Mutations in the gene that encodes this protein have been associated with autosomal recessive spondylocostal dysostosis 3.
- Molecular Weight
- 39 kDa (MW of target protein)
- Pathways
- Notch Signaling
-