ST8SIA6 antibody (Middle Region)

Catalog No. ABIN634897

Product Details anti-ST8SIA6 Antibody

Target: ST8SIA6 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 6 (ST8SIA6))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ST8SIA6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ST8 SIA6 antibody was raised against the middle region of ST8 IA6

Purification: Affinity purified

Immunogen: ST8 SIA6 antibody was raised using the middle region of ST8 IA6 corresponding to a region with amino acids LEESKARQKVLFFHPKYLKDLALFWRTKGVTAYRLSTGLMITSVAVELCK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ST8SIA6 Blocking Peptide, catalog no. 33R-4893, is also available for use as a blocking control in assays to test for specificity of this ST8SIA6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 IA6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ST8SIA6

Target: ST8SIA6 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 6 (ST8SIA6))

Alternative Name: ST8SIA6 (ST8SIA6 Products)

Synonyms: Siat8f antibody, SIAT8F antibody, siat8F antibody, siat 8F antibody, wu:fa12f08 antibody, wu:fb95c11 antibody, SIA8F antibody, ST8SIA-VI antibody, 1700007J08Rik antibody, AI314453 antibody, AI875066 antibody, ST8SiaVI antibody, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 6 antibody, St8sia6 antibody, ST8SIA6 antibody, st8sia6 antibody, LOC592192 antibody

Background: Sialic acid is a key determinate of oligosaccharide structures involved in cell-cell communication, cell-substrate interaction, adhesion, and protein targeting.

Molecular Weight: 45 kDa (MW of target protein)