Tmc2 antibody (Middle Region)
-
- Target See all Tmc2 Antibodies
- Tmc2 (Transmembrane Channel-Like 2 (Tmc2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Tmc2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TMC2 antibody was raised against the middle region of TMC2
- Purification
- Affinity purified
- Immunogen
- TMC2 antibody was raised using the middle region of TMC2 corresponding to a region with amino acids YCWCWDLEAGFPSYAEFDISGNVLGLIFNQGMIWMGSFYAPGLVGINVLR
- Top Product
- Discover our top product Tmc2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TMC2 Blocking Peptide, catalog no. 33R-10062, is also available for use as a blocking control in assays to test for specificity of this TMC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Tmc2 (Transmembrane Channel-Like 2 (Tmc2))
- Alternative Name
- TMC2 (Tmc2 Products)
- Background
- TMC2 is considered a member of transmembrane proteins family. The specific function of this gene is unknown, however, expression in the inner ear suggests that it may be crucial for normal auditory function. This gene is considered a member of a gene family predicted to encode transmembrane proteins.
- Molecular Weight
- 102 kDa (MW of target protein)
-