Plexin A2 antibody (N-Term)
-
- Target See all Plexin A2 (Plxna2) Antibodies
- Plexin A2 (Plxna2)
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Plexin A2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Plexin A2 antibody was raised against the N terminal of PLXNA2
- Purification
- Affinity purified
- Immunogen
- Plexin A2 antibody was raised using the N terminal of PLXNA2 corresponding to a region with amino acids SVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGSPIL
- Top Product
- Discover our top product Plxna2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Plexin A2 Blocking Peptide, catalog no. 33R-8901, is also available for use as a blocking control in assays to test for specificity of this Plexin A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLXNA2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Plexin A2 (Plxna2)
- Alternative Name
- Plexin A2 (Plxna2 Products)
- Background
- PLXNA2 is a member of the plexin-A family of semaphorin co-receptors. Semaphorins are a large family of secreted or membrane-bound proteins that mediate repulsive effects on axon pathfinding during nervous system development. A subset of semaphorins are recognised by plexin-A/neuropilin transmembrane receptor complexes, triggering a cellular signal transduction cascade that leads to axon repulsion.
- Molecular Weight
- 211 kDa (MW of target protein)
-