Plexin A2 antibody (N-Term)

Catalog No. ABIN634887

Product Details anti-Plexin A2 Antibody

Target: Plexin A2 (Plxna2)

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Plexin A2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Plexin A2 antibody was raised against the N terminal of PLXNA2

Purification: Affinity purified

Immunogen: Plexin A2 antibody was raised using the N terminal of PLXNA2 corresponding to a region with amino acids SVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGSPIL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Plexin A2 Blocking Peptide, catalog no. 33R-8901, is also available for use as a blocking control in assays to test for specificity of this Plexin A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLXNA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Plexin A2

Target: Plexin A2 (Plxna2)

Alternative Name: Plexin A2 (Plxna2 Products)

Synonyms: oct antibody, plxn2 antibody, OCT antibody, PLXN2 antibody, 2810428A13Rik antibody, AA589422 antibody, AW457381 antibody, Plxn2 antibody, mKIAA0463 antibody, plexin A2 antibody, plexin-A2 antibody, PLXNA2 antibody, plxna2 antibody, LOC100078346 antibody, Plxna2 antibody

Background: PLXNA2 is a member of the plexin-A family of semaphorin co-receptors. Semaphorins are a large family of secreted or membrane-bound proteins that mediate repulsive effects on axon pathfinding during nervous system development. A subset of semaphorins are recognised by plexin-A/neuropilin transmembrane receptor complexes, triggering a cellular signal transduction cascade that leads to axon repulsion.

Molecular Weight: 211 kDa (MW of target protein)