GRAMD2 antibody (Middle Region)

Catalog No. ABIN634882

Product Details anti-GRAMD2 Antibody

Target: GRAMD2 (GRAM Domain Containing 2 (GRAMD2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GRAMD2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GRAMD2 antibody was raised against the middle region of GRAMD2

Purification: Affinity purified

Immunogen: GRAMD2 antibody was raised using the middle region of GRAMD2 corresponding to a region with amino acids LPNGLAITTNTSQKYIFVSLLSRDSVYDLLRRVCTHLQPSSKKSLSVREF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GRAMD2 Blocking Peptide, catalog no. 33R-5276, is also available for use as a blocking control in assays to test for specificity of this GRAMD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRAMD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GRAMD2

Target: GRAMD2 (GRAM Domain Containing 2 (GRAMD2))

Alternative Name: GRAMD2 (GRAMD2 Products)

Synonyms: BC064463 antibody, RGD1564007 antibody, Gramd2 antibody, GRAM domain containing 2 antibody, GRAM domain containing 2A antibody, Gramd2 antibody, GRAMD2A antibody, Gramd2a antibody

Background: The function of GRAMD2 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 40 kDa (MW of target protein)