SLC26A1 antibody

Catalog No. ABIN634881

Product Details anti-SLC26A1 Antibody

Target: SLC26A1 (Solute Carrier Family 26 (Sulfate Transporter), Member 1 (SLC26A1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC26A1 antibody is un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLC26 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LYSLTGLDAGCMAARRKEGGSETGVGEGGPAQGEDLGPVSTRAALVPAAA

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC26A1 Blocking Peptide, catalog no. 33R-5575, is also available for use as a blocking control in assays to test for specificity of this SLC26A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC26A1

Target: SLC26A1 (Solute Carrier Family 26 (Sulfate Transporter), Member 1 (SLC26A1))

Alternative Name: SLC26A1 (SLC26A1 Products)

Synonyms: edm4 antibody, sat1 antibody, sat-1 antibody, MGC86347 antibody, SLC26A1 antibody, sb:cb565 antibody, wu:fe23c03 antibody, zgc:158435 antibody, EDM4 antibody, SAT-1 antibody, SAT1 antibody, Sat1 antibody, solute carrier family 26 (anion exchanger), member 1 L homeolog antibody, solute carrier family 26 member 1 antibody, solute carrier family 26 (anion exchanger), member 1 antibody, solute carrier family 26 (sulfate transporter), member 1 antibody, slc26a1.L antibody, SLC26A1 antibody, slc26a1 antibody, Slc26a1 antibody

Background: SLC26A1 is a member of sulfate/anion transporter family. Family members are well conserved in their protein (aa length among species) structures, but have markedly different tissue expression patterns. Its gene is primarily expressed in the liver, pancreas, and brain.

Molecular Weight: 77 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process, Ribonucleoside Biosynthetic Process, Dicarboxylic Acid Transport