GPR75 antibody (Middle Region)
-
- Target See all GPR75 Antibodies
- GPR75 (G Protein-Coupled Receptor 75 (GPR75))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GPR75 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GPR75 antibody was raised against the middle region of GPR75
- Purification
- Affinity purified
- Immunogen
- GPR75 antibody was raised using the middle region of GPR75 corresponding to a region with amino acids GQSSSTPINTRIEPYYSIYNSSPSQEESSPCNLQPVNSFGFANSYIAMHY
- Top Product
- Discover our top product GPR75 Primary Antibody
-
anti-G Protein-Coupled Receptor 75 (GPR75) (AA 372-540) antibody
GPR75 Reactivity: Human WB, ELISA, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-G Protein-Coupled Receptor 75 (GPR75) (Extracellular Domain) antibodyGPR75 Reactivity: Human, Horse, Monkey, Bat, Xenopus laevis IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-G Protein-Coupled Receptor 75 (GPR75) (C-Term) antibodyGPR75 Reactivity: Human, Horse, Cow, Pig, Rabbit, Monkey, Bat IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-G Protein-Coupled Receptor 75 (GPR75) (Cytoplasmic Domain) antibodyGPR75 Reactivity: Human, Horse, Cow, Pig IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-G Protein-Coupled Receptor 75 (GPR75) (C-Term) antibodyGPR75 Reactivity: Human, Rat, Horse, Cow, Pig, Rabbit, Monkey, Hamster, Bat, Xenopus laevis, Chicken IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-G Protein-Coupled Receptor 75 (GPR75) (C-Term) antibodyGPR75 Reactivity: Human, Horse, Cow, Pig, Rabbit, Monkey, Hamster IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-G Protein-Coupled Receptor 75 (GPR75) (AA 270-319) antibodyGPR75 Reactivity: Human, Rabbit, Monkey, Hamster WB Host: Rabbit Polyclonal unconjugated
anti-G Protein-Coupled Receptor 75 (GPR75) (Middle Region) antibodyGPR75 Reactivity: Human, Mouse, Rat, Horse, Cow, Pig, Rabbit, Zebrafish (Danio rerio) WB Host: Rabbit Polyclonal unconjugated
anti-G Protein-Coupled Receptor 75 (GPR75) (C-Term) antibodyGPR75 Reactivity: Human WB, ELISA, IF Host: Rabbit Polyclonal unconjugated
anti-G Protein-Coupled Receptor 75 (GPR75) (AA 151-250) antibodyGPR75 Reactivity: Mouse WB, ELISA, IHC (p), ICC, IF (cc), IF (p), IHC (fro) Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GPR75 Blocking Peptide, catalog no. 33R-3513, is also available for use as a blocking control in assays to test for specificity of this GPR75 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR75 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GPR75 (G Protein-Coupled Receptor 75 (GPR75))
- Alternative Name
- GPR75 (GPR75 Products)
- Synonyms
- GPR75 antibody, GPRchr2 antibody, WI31133 antibody, G protein-coupled receptor 75 antibody, G protein-coupled receptor 75 S homeolog antibody, GPR75 antibody, gpr75 antibody, Gpr75 antibody, gpr75.S antibody
- Background
- GPR75 is a member of the G protein-coupled receptor family. GPRs are cell surface receptors that activate guanine-nucleotide binding proteins upon the binding of a ligand.GPR75 is a member of the G protein-coupled receptor family. GPRs are cell surface receptors that activate guanine-nucleotide binding proteins upon the binding of a ligand.
- Molecular Weight
- 59 kDa (MW of target protein)
-
