ENTPD7 antibody (C-Term)
-
- Target See all ENTPD7 Antibodies
- ENTPD7 (Ectonucleoside Triphosphate diphosphohydrolase 7 (ENTPD7))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ENTPD7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ENTPD7 antibody was raised against the C terminal of ENTPD7
- Purification
- Affinity purified
- Immunogen
- ENTPD7 antibody was raised using the C terminal of ENTPD7 corresponding to a region with amino acids EHRLKYQCFKSAWMYQVLHEGFHFPYDYPNLRTAQLVYDREVQWTLGAIL
- Top Product
- Discover our top product ENTPD7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ENTPD7 Blocking Peptide, catalog no. 33R-2459, is also available for use as a blocking control in assays to test for specificity of this ENTPD7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENTPD7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ENTPD7 (Ectonucleoside Triphosphate diphosphohydrolase 7 (ENTPD7))
- Alternative Name
- ENTPD7 (ENTPD7 Products)
- Synonyms
- LALP1 antibody, NTPDase7 antibody, RP11-483F11.1 antibody, 1810012B13Rik antibody, 1810020C02Rik antibody, 2810003F23Rik antibody, Lysal2 antibody, ectonucleoside triphosphate diphosphohydrolase 7 antibody, ectonucleoside triphosphate diphosphohydrolase 7 L homeolog antibody, ENTPD7 antibody, entpd7 antibody, entpd7.L antibody, Entpd7 antibody
- Background
- ENTPD7 is a multi-pass membrane protein.It belongs to the GDA1/CD39 NTPase family. It preferentially hydrolyzes nucleoside 5'-triphosphates. The order of activity with respect to possible substrates is UTP > GTP > CTP.
- Molecular Weight
- 69 kDa (MW of target protein)
-