DNASE1 antibody (N-Term)
-
- Target See all DNASE1 Antibodies
- DNASE1 (Deoxyribonuclease I (DNASE1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DNASE1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DNASE1 antibody was raised against the N terminal of DNASE1
- Purification
- Affinity purified
- Immunogen
- DNASE1 antibody was raised using the N terminal of DNASE1 corresponding to a region with amino acids GKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYD
- Top Product
- Discover our top product DNASE1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DNASE1 Blocking Peptide, catalog no. 33R-3371, is also available for use as a blocking control in assays to test for specificity of this DNASE1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNASE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DNASE1 (Deoxyribonuclease I (DNASE1))
- Alternative Name
- DNASE1 (DNASE1 Products)
- Background
- This gene encodes a member of the DNase family. This protein is stored in the zymogen granules of the nuclear envelope and functions by cleaving DNA in an endonucleolytic manner. At least six autosomal codominant alleles have been characterized.
- Molecular Weight
- 29 kDa (MW of target protein)
-