KLHL31 antibody
-
- Target See all KLHL31 Antibodies
- KLHL31 (Kelch-Like 31 (KLHL31))
-
Reactivity
- Mouse, Human, Dog, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KLHL31 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogen
- KLHL31 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSPATGQWSYAAP
- Top Product
- Discover our top product KLHL31 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KLHL31 Blocking Peptide, catalog no. 33R-9231, is also available for use as a blocking control in assays to test for specificity of this KLHL31 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL31 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KLHL31 (Kelch-Like 31 (KLHL31))
- Alternative Name
- KLHL31 (KLHL31 Products)
- Background
- KLHL31 is a transcriptional repressor in MAPK/JNK signaling pathway to regulate cellular functions. Overexpression inhibits the transcriptional activities of both the TPA-response element (TRE) and serum response element (SRE)
- Molecular Weight
- 70 kDa (MW of target protein)
-