ABCD4 antibody
-
- Target See all ABCD4 Antibodies
- ABCD4 (ATP-Binding Cassette, Sub-Family D (Ald), Member 4 (ABCD4))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ABCD4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ABCD4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YVSWRKDLTEHLHRLYFRGRAYYTLNVLRDDIDNPDQRISQDVERFCRQL
- Top Product
- Discover our top product ABCD4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ABCD4 Blocking Peptide, catalog no. 33R-10287, is also available for use as a blocking control in assays to test for specificity of this ABCD4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCD4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ABCD4 (ATP-Binding Cassette, Sub-Family D (Ald), Member 4 (ABCD4))
- Alternative Name
- ABCD4 (ABCD4 Products)
- Synonyms
- ABC41 antibody, EST352188 antibody, MAHCJ antibody, P70R antibody, P79R antibody, PMP69 antibody, PXMP1L antibody, Pxmp1l antibody, ABCD4 antibody, zgc:153503 antibody, P69r antibody, ATP binding cassette subfamily D member 4 antibody, ATP-binding cassette, sub-family D (ALD), member 4 antibody, ABCD4 antibody, Abcd4 antibody, abcd4 antibody
- Background
- ABCD4 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. The function of this peroxisomal membrane protein is unknown.
- Molecular Weight
- 68 kDa (MW of target protein)
-