AREL1 antibody (Middle Region)

Catalog No. ABIN634861

Product Details anti-AREL1 Antibody

Target: AREL1 (Apoptosis Resistant E3 Ubiquitin Protein Ligase 1 (AREL1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AREL1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KIAA0317 antibody was raised against the middle region of KIAA0317

Purification: Affinity purified

Immunogen: KIAA0317 antibody was raised using the middle region of KIAA0317 corresponding to a region with amino acids VRARFTRSFLAQIIGLRMHYKYFETDDPEFYKSKVCFILNNDMSEMELVF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIAA0317 Blocking Peptide, catalog no. 33R-9768, is also available for use as a blocking control in assays to test for specificity of this KIAA0317 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0317 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AREL1

Target: AREL1 (Apoptosis Resistant E3 Ubiquitin Protein Ligase 1 (AREL1))

Alternative Name: KIAA0317 (AREL1 Products)

Synonyms: KIAA0317 antibody, apoptosis resistant E3 ubiquitin protein ligase 1 antibody, AREL1 antibody

Background: KIAA0317 contains 1 filamin repeat and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. The exact function of KIAA0317 remains unknown.

Molecular Weight: 94 kDa (MW of target protein)