RNF170 antibody (C-Term)

Catalog No. ABIN634858

Product Details anti-RNF170 Antibody

Target: RNF170 (Ring Finger Protein 170 (RNF170))

Binding Specificity: C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF170 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RNF170 antibody was raised against the C terminal of RNF170

Purification: Affinity purified

Immunogen: RNF170 antibody was raised using the C terminal of RNF170 corresponding to a region with amino acids FYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVITQRLTR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF170 Blocking Peptide, catalog no. 33R-3138, is also available for use as a blocking control in assays to test for specificity of this RNF170 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF170 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF170

Target: RNF170 (Ring Finger Protein 170 (RNF170))

Alternative Name: RNF170 (RNF170 Products)

Synonyms: SNAX1 antibody, 6720407G21Rik antibody, AI481227 antibody, ring finger protein 170 antibody, ring finger protein 170 L homeolog antibody, microRNA 4469 antibody, Rnf170 antibody, RNF170 antibody, rnf170.L antibody, MIR4469 antibody

Background: RNF170 is a multi-pass membrane proteinPotential. It contains 1 RING-type zinc finger. The exact function of RNF170 remains unknown.

Molecular Weight: 30 kDa (MW of target protein)