-
- Target See all PDE3A Antibodies
- PDE3A (phosphodiesterase 3A, cGMP-Inhibited (PDE3A))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PDE3A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PDE3 A antibody was raised against the N terminal of PDE3
- Purification
- Affinity purified
- Immunogen
- PDE3 A antibody was raised using the N terminal of PDE3 corresponding to a region with amino acids LLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSD
- Top Product
- Discover our top product PDE3A Primary Antibody
-
anti-phosphodiesterase 3A, cGMP-Inhibited (PDE3A) antibody
PDE3A Reactivity: Human, Rat, Mouse IHC, IF Host: Rabbit Polyclonal unconjugated
anti-phosphodiesterase 3A, cGMP-Inhibited (PDE3A) (AA 533-640) antibodyPDE3A Reactivity: Human WB, ELISA, IF Host: Mouse Monoclonal 2D7 unconjugated
anti-phosphodiesterase 3A, cGMP-Inhibited (PDE3A) (AA 380-660) antibodyPDE3A Reactivity: Human WB, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-phosphodiesterase 3A, cGMP-Inhibited (PDE3A) (AA 948-1141) antibodyPDE3A Reactivity: Rat WB, IP, IHC, ICC Host: Rabbit Polyclonal unconjugated
anti-phosphodiesterase 3A, cGMP-Inhibited (PDE3A) (Internal Region) antibodyPDE3A Reactivity: Human, Rat, Mouse, Monkey, Horse IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-phosphodiesterase 3A, cGMP-Inhibited (PDE3A) (AA 533-640) antibodyPDE3A Reactivity: Human WB, ELISA Host: Mouse Monoclonal 5C12 unconjugated
anti-phosphodiesterase 3A, cGMP-Inhibited (PDE3A) (AA 533-640) antibodyPDE3A Reactivity: Human WB, ELISA Host: Mouse Polyclonal unconjugated
anti-phosphodiesterase 3A, cGMP-Inhibited (PDE3A) (AA 360-409) antibodyPDE3A Reactivity: Human, Monkey, Cow, Pig, Horse WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PDE3A Blocking Peptide, catalog no. 33R-5115, is also available for use as a blocking control in assays to test for specificity of this PDE3A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PDE3A (phosphodiesterase 3A, cGMP-Inhibited (PDE3A))
- Alternative Name
- PDE3A (PDE3A Products)
- Synonyms
- PDE3A antibody, Pde3a antibody, si:dkey-48h7.2 antibody, A930022O17Rik antibody, C87899 antibody, RNPDE3A antibody, CGI-PDE antibody, CGI-PDE A antibody, CGI-PDE-A antibody, phosphodiesterase 3A antibody, phosphodiesterase 3A, cGMP-inhibited antibody, cGMP-inhibited 3',5'-cyclic phosphodiesterase A antibody, phosphodiesterase 3A, cGMP inhibited antibody, PDE3A antibody, Pde3a antibody, LOC100540515 antibody, pde3a antibody
- Background
- PDE3A belongs to the cyclic nucleotide phosphodiesterase family. It hydrolyzes both cyclic AMP (cAMP) and cyclic GMP (cGMP).
- Molecular Weight
- 125 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process
-
You are here:
