TMEM135 antibody (N-Term)

Catalog No. ABIN634847

Product Details anti-TMEM135 Antibody

Target: TMEM135 (Transmembrane Protein 135 (TMEM135))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM135 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM135 antibody was raised against the N terminal of TMEM135

Purification: Affinity purified

Immunogen: TMEM135 antibody was raised using the N terminal of TMEM135 corresponding to a region with amino acids SLKIYAPLYLIAAILRKRKLDYYLHKLLPEILQSASFLTANGALYMAFFC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM135 Blocking Peptide, catalog no. 33R-8601, is also available for use as a blocking control in assays to test for specificity of this TMEM135 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM135 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM135

Target: TMEM135 (Transmembrane Protein 135 (TMEM135))

Alternative Name: TMEM135 (TMEM135 Products)

Synonyms: im:6901522 antibody, zgc:162425 antibody, PMP52 antibody, 2810439K08Rik antibody, AW319712 antibody, RGD1309948 antibody, transmembrane protein 135 antibody, transmembrane protein 135 L homeolog antibody, TMEM135 antibody, tmem135 antibody, CpipJ_CPIJ008774 antibody, tmem135.L antibody, Tmem135 antibody

Background: TMEM135 protein is part of a conserved genetic network involved in fat storage and longevity regulation.

Molecular Weight: 52 kDa (MW of target protein)