SIL1 antibody

Catalog No. ABIN634845

Product Details anti-SIL1 Antibody

Target: SIL1 (Nucleotide Exchange Factor SIL1 (SIL1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SIL1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SIL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLQQYRQVHLLPGLWEQGWCEITAHLLALPEHDAREKVLQTLGVLLTTCR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SIL1 Blocking Peptide, catalog no. 33R-4531, is also available for use as a blocking control in assays to test for specificity of this SIL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SIL1

Target: SIL1 (Nucleotide Exchange Factor SIL1 (SIL1))

Alternative Name: SIL1 (SIL1 Products)

Synonyms: 1810057E01Rik antibody, AI042831 antibody, wz antibody, BAP antibody, MSS antibody, ULG5 antibody, endoplasmic reticulum chaperone SIL1 homolog (S. cerevisiae) antibody, SIL1 nucleotide exchange factor L homeolog antibody, SIL1 nucleotide exchange factor antibody, Sil1 antibody, sil1.L antibody, SIL1 antibody

Background: SIL1 is a resident endoplasmic reticulum (ER), N-linked glycoprotein with an N-terminal ER targeting sequence, 2 putative N-glycosylation sites, and a C-terminal ER retention signal. This protein functions as a nucleotide exchange factor for another unfolded protein response protein. Mutations in its gene have been associated with Marinesco-Sjogren syndrome.

Molecular Weight: 49 kDa (MW of target protein)

Pathways: Unfolded Protein Response, SARS-CoV-2 Protein Interactome