SLC43A2 antibody (N-Term)

Catalog No. ABIN634843

Product Details anti-SLC43A2 Antibody

Target: SLC43A2 (Solute Carrier Family 43, Member 2 (SLC43A2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC43A2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC43 A2 antibody was raised against the N terminal of SLC43 2

Purification: Affinity purified

Immunogen: SLC43 A2 antibody was raised using the N terminal of SLC43 2 corresponding to a region with amino acids TEPENVTNGTVGGTAEPGHEEVSWMNGWLSCQAQDEMLNLAFTVGSFLLS

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC43A2 Blocking Peptide, catalog no. 33R-9053, is also available for use as a blocking control in assays to test for specificity of this SLC43A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC43A2

Target: SLC43A2 (Solute Carrier Family 43, Member 2 (SLC43A2))

Alternative Name: SLC43A2 (SLC43A2 Products)

Synonyms: LAT4 antibody, lat4 antibody, MGC122003 antibody, 7630402D21Rik antibody, BC042513 antibody, Lat4 antibody, RGD1305819 antibody, si:dkey-118k5.2 antibody, slc43a2 antibody, zgc:56271 antibody, DKFZp469D1521 antibody, cb941 antibody, wu:fb37c04 antibody, wu:fb38e03 antibody, wu:fb52a10 antibody, wu:fi32b04 antibody, xx:lithzf000079 antibody, zgc:103664 antibody, solute carrier family 43 member 2 antibody, solute carrier family 43 (amino acid system L transporter), member 2 antibody, solute carrier family 43, member 2 antibody, solute carrier family 43 (amino acid system L transporter), member 2a antibody, solute carrier family 43 (amino acid system L transporter), member 2 L homeolog antibody, solute carrier family 43 (amino acid system L transporter), member 2b antibody, SLC43A2 antibody, slc43a2 antibody, Slc43a2 antibody, slc43a2a antibody, slc43a2.L antibody, slc43a2b antibody

Background: SLC43A2 is a Sodium-, chloride, pH-independent high affinity transport of large neutral amino acids.

Molecular Weight: 53 kDa (MW of target protein)