Arylsulfatase H antibody (Middle Region)
-
- Target See all Arylsulfatase H (ARSH) Antibodies
- Arylsulfatase H (ARSH)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Arylsulfatase H antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ARSH antibody was raised against the middle region of ARSH
- Purification
- Affinity purified
- Immunogen
- ARSH antibody was raised using the middle region of ARSH corresponding to a region with amino acids FIERYKREPFLLFFSFLHVHTPLISKKKFVGRSKYGRYGDNVEEMDWMVG
- Top Product
- Discover our top product ARSH Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ARSH Blocking Peptide, catalog no. 33R-2924, is also available for use as a blocking control in assays to test for specificity of this ARSH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARSH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Arylsulfatase H (ARSH)
- Alternative Name
- ARSH (ARSH Products)
- Synonyms
- ARSH antibody, LOC100232370 antibody, sulfatase antibody, arylsulfatase family member H antibody, arylsulfatase D antibody, ARSH antibody, LOC100232370 antibody, LOC100229427 antibody
- Background
- Sulfatases, such as ARSH, hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules.
- Molecular Weight
- 63 kDa (MW of target protein)
-