Seladin 1 antibody (N-Term)
-
- Target See all Seladin 1 (DHCR24) Antibodies
- Seladin 1 (DHCR24) (24-Dehydrocholesterol Reductase (DHCR24))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Seladin 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DHCR24 antibody was raised against the N terminal of DHCR24
- Purification
- Affinity purified
- Immunogen
- DHCR24 antibody was raised using the N terminal of DHCR24 corresponding to a region with amino acids FLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQRVRDIQKQVREWKEQGSK
- Top Product
- Discover our top product DHCR24 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DHCR24 Blocking Peptide, catalog no. 33R-2970, is also available for use as a blocking control in assays to test for specificity of this DHCR24 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHCR24 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Seladin 1 (DHCR24) (24-Dehydrocholesterol Reductase (DHCR24))
- Alternative Name
- DHCR24 (DHCR24 Products)
- Background
- DHCR24 is a flavin adenine dinucleotide (FAD)-dependent oxidoreductase which catalyzes the reduction of the delta-24 double bond of sterol intermediates during cholesterol biosynthesis. The protein contains a leader sequence that directs it to the endoplasmic reticulum membrane. Missense mutations in this gene have been associated with desmosterolosis. Also, reduced expression of the gene occurs in the temporal cortex of Alzheimer disease patients and overexpression has been observed in adrenal gland cancer cells.
- Molecular Weight
- 58 kDa (MW of target protein)
-