Seladin 1 antibody (N-Term)

Catalog No. ABIN634838

Product Details anti-Seladin 1 Antibody

Target: Seladin 1 (DHCR24) (24-Dehydrocholesterol Reductase (DHCR24))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Seladin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DHCR24 antibody was raised against the N terminal of DHCR24

Purification: Affinity purified

Immunogen: DHCR24 antibody was raised using the N terminal of DHCR24 corresponding to a region with amino acids FLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQRVRDIQKQVREWKEQGSK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DHCR24 Blocking Peptide, catalog no. 33R-2970, is also available for use as a blocking control in assays to test for specificity of this DHCR24 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHCR24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Seladin 1

Target: Seladin 1 (DHCR24) (24-Dehydrocholesterol Reductase (DHCR24))

Alternative Name: DHCR24 (DHCR24 Products)

Synonyms: MGC82737 antibody, zgc:101638 antibody, DCE antibody, Nbla03646 antibody, SELADIN1 antibody, seladin-1 antibody, 2310076D10Rik antibody, 5830417J06Rik antibody, mKIAA0018 antibody, 24-dehydrocholesterol reductase antibody, 24-dehydrocholesterol reductase S homeolog antibody, delta(24)-sterol reductase antibody, DHCR24 antibody, dhcr24.S antibody, dhcr24 antibody, LOC5575872 antibody, CpipJ_CPIJ000670 antibody, Dhcr24 antibody

Background: DHCR24 is a flavin adenine dinucleotide (FAD)-dependent oxidoreductase which catalyzes the reduction of the delta-24 double bond of sterol intermediates during cholesterol biosynthesis. The protein contains a leader sequence that directs it to the endoplasmic reticulum membrane. Missense mutations in this gene have been associated with desmosterolosis. Also, reduced expression of the gene occurs in the temporal cortex of Alzheimer disease patients and overexpression has been observed in adrenal gland cancer cells.

Molecular Weight: 58 kDa (MW of target protein)