RNF19A antibody (N-Term)

Catalog No. ABIN634836

Product Details anti-RNF19A Antibody

Target: RNF19A (Ring Finger Protein 19A (RNF19A))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF19A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RNF19 A antibody was raised against the N terminal of RNF19

Purification: Affinity purified

Immunogen: RNF19 A antibody was raised using the N terminal of RNF19 corresponding to a region with amino acids IFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF19A Blocking Peptide, catalog no. 33R-3962, is also available for use as a blocking control in assays to test for specificity of this RNF19A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF19A

Target: RNF19A (Ring Finger Protein 19A (RNF19A))

Alternative Name: RNF19A (RNF19A Products)

Synonyms: RNF19 antibody, RNF19A antibody, AA032313 antibody, Dorfin antibody, Rnf19 antibody, UIP117 antibody, Ubce7ip2 antibody, XYbp antibody, ring finger protein 19A, RBR E3 ubiquitin protein ligase antibody, ring finger protein 19A antibody, RNF19A antibody, Rnf19a antibody

Background: RNF19A contains two RING-finger motifs and an IBR (in between RING fingers) motif. This protein is an E3 ubiquintin ligase that is localized in Lewy bodies (LBs), a characteristic neuronal inclusion in Parkinson's disease (PD) brains. This protein interacts with UBE2L3/UBCH7 and UBE2E2/UBCH8, but not other ubiquitin-conjugating enzymes. This protein is found to bind and ubiquitylate synphilin 1 (SNCAIP), which is a interacting protein of alpha synuclein in neurons, and a major component of LB.

Molecular Weight: 91 kDa (MW of target protein)