CTDNEP1A antibody
-
- Target See all CTDNEP1A Antibodies
- CTDNEP1A (CTD Nuclear Envelope Phosphatase 1a (CTDNEP1A))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CTDNEP1A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DULLARD antibody was raised using a synthetic peptide corresponding to a region with amino acids HPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW
- Top Product
- Discover our top product CTDNEP1A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DULLARD Blocking Peptide, catalog no. 33R-3807, is also available for use as a blocking control in assays to test for specificity of this DULLARD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DULLARD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CTDNEP1A (CTD Nuclear Envelope Phosphatase 1a (CTDNEP1A))
- Alternative Name
- DULLARD (CTDNEP1A Products)
- Background
- DULLARD is a serine/threonine phosphatase which may be required for proper nuclear membrane morphology. DULLARD was involved in LPIN1 dephosphorylation. It may antagonize BMP signaling.
- Molecular Weight
- 28 kDa (MW of target protein)
-