G6PC antibody (N-Term)
-
- Target See all G6PC Antibodies
- G6PC (Glucose 6-Phosphatase, Catalytic (G6PC))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This G6PC antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- G6 PC antibody was raised against the N terminal of G6 C
- Purification
- Affinity purified
- Immunogen
- G6 PC antibody was raised using the N terminal of G6 C corresponding to a region with amino acids NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM
- Top Product
- Discover our top product G6PC Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
G6PC Blocking Peptide, catalog no. 33R-6784, is also available for use as a blocking control in assays to test for specificity of this G6PC antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of G0 C antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- G6PC (Glucose 6-Phosphatase, Catalytic (G6PC))
- Alternative Name
- G6PC (G6PC Products)
- Background
- G6PC hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. It forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels.
- Molecular Weight
- 40 kDa (MW of target protein)
- Pathways
- Carbohydrate Homeostasis, Cellular Glucan Metabolic Process
-