SUN1 antibody

Catalog No. ABIN634826

Product Details anti-SUN1 Antibody

Target: SUN1 (Sad1 and UNC84 Domain Containing 1 (SUN1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SUN1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: UNC84 A antibody was raised using a synthetic peptide corresponding to a region with amino acids QDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UNC84A Blocking Peptide, catalog no. 33R-7492, is also available for use as a blocking control in assays to test for specificity of this UNC84A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SUN1

Target: SUN1 (Sad1 and UNC84 Domain Containing 1 (SUN1))

Alternative Name: UNC84A (SUN1 Products)

Synonyms: UNC84A antibody, 4632417G13Rik antibody, 5730434D03Rik antibody, Unc84a antibody, mKIAA0810 antibody, Sun domain-containing protein 1 antibody, Sad1 and UNC84 domain containing 1 antibody, sun-1 antibody, SUN1 antibody, Sun1 antibody

Background: This gene is a member of the unc-84 homolog family and encodes a nuclear nuclear envelope protein with an Unc84 (SUN) domain. The protein is involved in nuclear anchorage and migration. Several alternatively spliced transcript variants of this gene have been described, however, the full-length nature of some of these variants has not been determined.

Molecular Weight: 78 kDa (MW of target protein)

Pathways: Maintenance of Protein Location