FMO4 antibody (N-Term)
-
- Target See all FMO4 Antibodies
- FMO4 (Flavin Containing Monooxygenase 4 (FMO4))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FMO4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FMO4 antibody was raised against the N terminal of FMO4
- Purification
- Affinity purified
- Immunogen
- FMO4 antibody was raised using the N terminal of FMO4 corresponding to a region with amino acids MVCTGHFLNPHLPLEAFPGIHKFKGQILHSQEYKIPEGFQGKRVLVIGLG
- Top Product
- Discover our top product FMO4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FMO4 Blocking Peptide, catalog no. 33R-6578, is also available for use as a blocking control in assays to test for specificity of this FMO4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FMO4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FMO4 (Flavin Containing Monooxygenase 4 (FMO4))
- Alternative Name
- FMO4 (FMO4 Products)
- Background
- FMO4 belongs to the FMO family. Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region.
- Molecular Weight
- 63 kDa (MW of target protein)
-