TMEM168 antibody (C-Term)

Catalog No. ABIN634819

Product Details anti-TMEM168 Antibody

Target: TMEM168 (Transmembrane Protein 168 (TMEM168))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM168 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM168 antibody was raised against the C terminal of TMEM168

Purification: Affinity purified

Immunogen: TMEM168 antibody was raised using the C terminal of TMEM168 corresponding to a region with amino acids EEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM168 Blocking Peptide, catalog no. 33R-2336, is also available for use as a blocking control in assays to test for specificity of this TMEM168 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM168 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM168

Target: TMEM168 (Transmembrane Protein 168 (TMEM168))

Alternative Name: TMEM168 (TMEM168 Products)

Synonyms: tmem168 antibody, si:dkey-192l17.1 antibody, flj13576 antibody, 5730526F17Rik antibody, 8430437G11Rik antibody, AI462344 antibody, AI504145 antibody, RGD1307778 antibody, transmembrane protein 168 antibody, transmembrane protein 168a antibody, transmembrane protein 168 S homeolog antibody, TMEM168 antibody, tmem168a antibody, tmem168.S antibody, Tmem168 antibody

Background: TMEM168 is a multi-pass membrane protein. It belongs to the TMEM168 family. The exact function of TMEM168 remains unknown.

Molecular Weight: 80 kDa (MW of target protein)