Peptide YY antibody (Middle Region)
-
- Target See all Peptide YY (PYY) Antibodies
- Peptide YY (PYY)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Peptide YY antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PYY antibody was raised against the middle region of PYY
- Purification
- Affinity purified
- Immunogen
- PYY antibody was raised using the middle region of PYY corresponding to a region with amino acids APREDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDTLLSKTFFPDGED
- Top Product
- Discover our top product PYY Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PYY Blocking Peptide, catalog no. 33R-1436, is also available for use as a blocking control in assays to test for specificity of this PYY antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYY antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Peptide YY (PYY)
- Alternative Name
- PYY (PYY Products)
- Synonyms
- PYY-I antibody, PYY1 antibody, GHYY antibody, RATGHYY antibody, Yy antibody, peptide-YY antibody, peptide YY antibody, peptide YY (mapped) antibody, PYY antibody, Pyy antibody
- Background
- This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.
- Molecular Weight
- 11 kDa (MW of target protein)
-