Peptide YY antibody (Middle Region)

Catalog No. ABIN634817

Product Details anti-Peptide YY Antibody

Target: Peptide YY (PYY)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Peptide YY antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PYY antibody was raised against the middle region of PYY

Purification: Affinity purified

Immunogen: PYY antibody was raised using the middle region of PYY corresponding to a region with amino acids APREDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDTLLSKTFFPDGED

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PYY Blocking Peptide, catalog no. 33R-1436, is also available for use as a blocking control in assays to test for specificity of this PYY antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYY antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Peptide YY

Target: Peptide YY (PYY)

Alternative Name: PYY (PYY Products)

Synonyms: PYY-I antibody, PYY1 antibody, GHYY antibody, RATGHYY antibody, Yy antibody, peptide-YY antibody, peptide YY antibody, peptide YY (mapped) antibody, PYY antibody, Pyy antibody

Background: This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.

Molecular Weight: 11 kDa (MW of target protein)