Hepcidin antibody (N-Term)

Catalog No. ABIN634809

Product Details anti-Hepcidin Antibody

Target: Hepcidin (HAMP) (Hepcidin Antimicrobial Peptide (HAMP))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Hepcidin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HAMP antibody was raised against the N terminal of HAMP

Purification: Affinity purified

Immunogen: HAMP antibody was raised using the N terminal of HAMP corresponding to a region with amino acids MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HAMP Blocking Peptide, catalog no. 33R-5697, is also available for use as a blocking control in assays to test for specificity of this HAMP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAMP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

References for anti-Hepcidin antibody (ABIN634809)

Blanchette-Farra, Kita, Konstorum, Tesfay, Lemler, Hegde, Claffey, Torti, Torti: "Contribution of three-dimensional architecture and tumor-associated fibroblasts to hepcidin regulation in breast cancer." in: Oncogene, Vol. 37, Issue 29, pp. 4013-4032, (2019) (PubMed).

Target Details for Hepcidin

Target: Hepcidin (HAMP) (Hepcidin Antimicrobial Peptide (HAMP))

Alternative Name: HAMP (HAMP Products)

Synonyms: HEPC antibody, HFE2B antibody, LEAP1 antibody, PLTR antibody, Hepcidin antibody, Hamp1 antibody, Hepc antibody, Hepc1 antibody, HAMP antibody, hepcidin antibody, hamp1 antibody, hep1 antibody, hepcidin antimicrobial peptide antibody, hepcidin-like antibody, hepcidin-1 antibody, Ham percentage antibody, HAMP antibody, Hamp antibody, hamp antibody, LOC100135935 antibody, LOC106584587 antibody

Background: The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption.

Molecular Weight: 9 kDa (MW of target protein)

Pathways: Hormone Activity, Transition Metal Ion Homeostasis