Hepcidin antibody (N-Term)
(1 reference)-
- Target See all Hepcidin (HAMP) Antibodies
- Hepcidin (HAMP) (Hepcidin Antimicrobial Peptide (HAMP))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Hepcidin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HAMP antibody was raised against the N terminal of HAMP
- Purification
- Affinity purified
- Immunogen
- HAMP antibody was raised using the N terminal of HAMP corresponding to a region with amino acids MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM
- Top Product
- Discover our top product HAMP Primary Antibody
-
anti-Hepcidin Antimicrobial Peptide (HAMP) (AA 25-84) antibody
HAMP Reactivity: Human WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Hepcidin Antimicrobial Peptide (HAMP) (AA 25-84) antibodyHAMP Reactivity: Human WB, IHC, IP, ICC Host: Mouse Monoclonal D7 unconjugated
anti-Hepcidin Antimicrobial Peptide (HAMP) (AA 24-83) antibodyHAMP Reactivity: Mouse WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Hepcidin Antimicrobial Peptide (HAMP) antibodyHAMP Reactivity: Human WB, IHC, ELISA Host: Rabbit Monoclonal 4C5 unconjugated Recombinant Antibody
anti-Hepcidin Antimicrobial Peptide (HAMP) (Internal Region) antibodyHAMP Reactivity: Human, Mouse, Rat WB, IHC, ELISA Host: Rabbit Polyclonal unconjugated
anti-Hepcidin Antimicrobial Peptide (HAMP) (AA 17-46) antibodyHAMP Reactivity: Human WB Host: Rabbit Polyclonal RB22098 unconjugated
anti-Hepcidin Antimicrobial Peptide (HAMP) (AA 25-84) antibodyHAMP Reactivity: Human WB, ELISA Host: Mouse Monoclonal 1F9 unconjugated
anti-Hepcidin Antimicrobial Peptide (HAMP) (AA 25-85) antibodyHAMP Reactivity: Human WB, IHC (p), EIA Host: Mouse Monoclonal 1F9 unconjugated
anti-Hepcidin Antimicrobial Peptide (HAMP) (AA 23-82) antibodyHAMP Reactivity: Pig WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Hepcidin Antimicrobial Peptide (HAMP) (AA 29-82) antibodyHAMP Reactivity: Cow WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HAMP Blocking Peptide, catalog no. 33R-5697, is also available for use as a blocking control in assays to test for specificity of this HAMP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAMP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
: "Contribution of three-dimensional architecture and tumor-associated fibroblasts to hepcidin regulation in breast cancer." in: Oncogene, Vol. 37, Issue 29, pp. 4013-4032, (2019) (PubMed).
-
: "Contribution of three-dimensional architecture and tumor-associated fibroblasts to hepcidin regulation in breast cancer." in: Oncogene, Vol. 37, Issue 29, pp. 4013-4032, (2019) (PubMed).
-
- Target
- Hepcidin (HAMP) (Hepcidin Antimicrobial Peptide (HAMP))
- Alternative Name
- HAMP (HAMP Products)
- Background
- The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption.
- Molecular Weight
- 9 kDa (MW of target protein)
- Pathways
- Hormone Activity, Transition Metal Ion Homeostasis
-
