LEFTY2 antibody (N-Term)

Catalog No. ABIN634801

Product Details anti-LEFTY2 Antibody

Target: LEFTY2 (Left-Right Determination Factor 2 (LEFTY2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LEFTY2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LEFTY2 antibody was raised against the N terminal of LEFTY2

Purification: Affinity purified

Immunogen: LEFTY2 antibody was raised using the N terminal of LEFTY2 corresponding to a region with amino acids MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LEFTY2 Blocking Peptide, catalog no. 33R-6619, is also available for use as a blocking control in assays to test for specificity of this LEFTY2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEFTY2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LEFTY2

Target: LEFTY2 (Left-Right Determination Factor 2 (LEFTY2))

Alternative Name: LEFTY2 (LEFTY2 Products)

Synonyms: EBAF antibody, LEFTA antibody, LEFTYA antibody, TGFB4 antibody, AI450052 antibody, Ebaf antibody, Leftb antibody, Stra3 antibody, Tgfb4 antibody, lefty antibody, lefty-1 antibody, atv2 antibody, cb720 antibody, fe38b03 antibody, wu:fe38b03 antibody, 6030463A22Rik antibody, AV214969 antibody, Lefta antibody, Ebaf2 antibody, left-right determination factor 2 antibody, left right determination factor 1 antibody, lefty2 antibody, Left-right determination factor 2 antibody, left-right determination factor 2-like antibody, LEFTY2 antibody, Lefty1 antibody, lft2 antibody, Lefty2 antibody, LOC699676 antibody, LOC100232580 antibody

Background: LEFTY2 is a member of the TGF-beta family of proteins. The protein is secreted and plays a role in left-right asymmetry determination of organ systems during development. The protein may also play a role in endometrial bleeding. Mutations in its gene have been associated with left-right axis malformations, particularly in the heart and lungs. Some types of infertility have been associated with dysregulated expression of its gene in the endometrium.

Molecular Weight: 40 kDa (MW of target protein)