LEFTY1 antibody (N-Term)
-
- Target See all LEFTY1 Antibodies
- LEFTY1 (Left-Right Determination Factor 1 (LEFTY1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LEFTY1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LEFTY1 antibody was raised against the N terminal of LEFTY1
- Purification
- Affinity purified
- Immunogen
- LEFTY1 antibody was raised using the N terminal of LEFTY1 corresponding to a region with amino acids MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEE
- Top Product
- Discover our top product LEFTY1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LEFTY1 Blocking Peptide, catalog no. 33R-6338, is also available for use as a blocking control in assays to test for specificity of this LEFTY1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEFTY1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LEFTY1 (Left-Right Determination Factor 1 (LEFTY1))
- Alternative Name
- LEFTY1 (LEFTY1 Products)
- Synonyms
- atv antibody, cb73 antibody, antivin antibody, ik:tdsubc_2b12 antibody, xx:tdsubc_2b12 antibody, LEFTY1 antibody, AI450052 antibody, Ebaf antibody, Leftb antibody, Stra3 antibody, Tgfb4 antibody, lefty antibody, lefty-1 antibody, RGD1561867 antibody, LEFTB antibody, LEFTYB antibody, lefty1 antibody, signaling molecule lefty1 antibody, left-right determination factor 1 antibody, left right determination factor 1 antibody, lft1 antibody, lefty1 antibody, LOC699924 antibody, LEFTY1 antibody, LOC100408003 antibody, LOC100597378 antibody, Lefty1 antibody
- Background
- LEFTY1 is a member of the TGF-beta family of proteins. A similar secreted protein in mouse plays a role in left-right asymmetry determination of organ systems during development.
- Molecular Weight
- 11 kDa (MW of target protein)
-