PDGFD antibody (N-Term)

Catalog No. ABIN634793

Product Details anti-PDGFD Antibody

Target: PDGFD (Platelet Derived Growth Factor D (PDGFD))

Binding Specificity: N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDGFD antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PDGFD antibody was raised against the N terminal of PDGFD

Purification: Affinity purified

Immunogen: PDGFD antibody was raised using the N terminal of PDGFD corresponding to a region with amino acids NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDGFD Blocking Peptide, catalog no. 33R-6641, is also available for use as a blocking control in assays to test for specificity of this PDGFD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDGFD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDGFD

Target: PDGFD (Platelet Derived Growth Factor D (PDGFD))

Alternative Name: PDGFD (PDGFD Products)

Synonyms: IEGF antibody, SCDGF-B antibody, SCDGFB antibody, Scdgfb antibody, rSCDGF-B antibody, PDGFD antibody, 1110003I09Rik antibody, platelet derived growth factor D antibody, platelet-derived growth factor, D polypeptide antibody, PDGFD antibody, Pdgfd antibody

Background: The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: RTK Signaling, Platelet-derived growth Factor Receptor Signaling