Stanniocalcin 1 antibody (N-Term)
-
- Target See all Stanniocalcin 1 (STC1) Antibodies
- Stanniocalcin 1 (STC1)
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Stanniocalcin 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- STC1 antibody was raised against the N terminal of STC1
- Purification
- Affinity purified
- Immunogen
- STC1 antibody was raised using the N terminal of STC1 corresponding to a region with amino acids MLQNSAVLLVLVISASATHEAEQNDSVSPRKSRVAAQNSAEVVRCLNSAL
- Top Product
- Discover our top product STC1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
STC1 Blocking Peptide, catalog no. 33R-6205, is also available for use as a blocking control in assays to test for specificity of this STC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Stanniocalcin 1 (STC1)
- Alternative Name
- STC1 (STC1 Products)
- Background
- STC1 is a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. It contains 11 conserved cysteine residues and is phosphorylated by protein kinase C exclusively on its serine residues. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Overexpression of human stanniocalcin 1 in mice produces high serum phosphate levels, dwarfism, and increased metabolic rate.
- Molecular Weight
- 26 kDa (MW of target protein)
- Pathways
- Hormone Activity
-