BDNF antibody (Middle Region)

Catalog No. ABIN634782

Product Details anti-BDNF Antibody

Target: BDNF (Brain-Derived Neurotrophic Factor (BDNF))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BDNF antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BDNF antibody was raised against the middle region of BDNF

Purification: Affinity purified

Immunogen: BDNF antibody was raised using the middle region of BDNF corresponding to a region with amino acids EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BDNF Blocking Peptide, catalog no. 33R-2813, is also available for use as a blocking control in assays to test for specificity of this BDNF antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BDNF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BDNF

Target: BDNF (Brain-Derived Neurotrophic Factor (BDNF))

Alternative Name: BDNF (BDNF Products)

Background: BDNF is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression BDNF is reduced in both Alzheimer's and Huntington disease patients. BDNF may play a role in the regulation of stress response and in the biology of mood disorders.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: RTK Signaling, Synaptic Membrane, Feeding Behaviour, Dicarboxylic Acid Transport, Regulation of long-term Neuronal Synaptic Plasticity