COPA antibody (N-Term)

Catalog No. ABIN634777

Product Details anti-COPA Antibody

Target: COPA (Coatomer Protein Complex, Subunit alpha (COPA))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This COPA antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: COPA antibody was raised against the N terminal of COPA

Purification: Affinity purified

Immunogen: COPA antibody was raised using the N terminal of COPA corresponding to a region with amino acids PWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGD

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

COPA Blocking Peptide, catalog no. 33R-7432, is also available for use as a blocking control in assays to test for specificity of this COPA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COPA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for COPA

Target: COPA (Coatomer Protein Complex, Subunit alpha (COPA))

Alternative Name: COPA (COPA Products)

Synonyms: COPA antibody, DDBDRAFT_0189693 antibody, DDBDRAFT_0233797 antibody, DDB_0189693 antibody, DDB_0233797 antibody, DKFZp469O221 antibody, AU040324 antibody, xenin antibody, HEP-COP antibody, cb281 antibody, fb13c12 antibody, wu:fb13c12 antibody, coatomer protein complex subunit alpha antibody, WD40 repeat-containing protein antibody, Coatomer subunit alpha antibody, coatomer protein complex, subunit alpha antibody, coatomer protein complex subunit alpha L homeolog antibody, COPA antibody, copA antibody, cgd8_860 antibody, Chro.80105 antibody, AFUA_3G08840 antibody, copa antibody, Copa antibody, copa.L antibody

Background: In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). The alpha-COP, encoded by COPA, shares high sequence similarity with RET1P, the alpha subunit of the coatomer complex in yeast. Also, the N-terminal 25 amino acids of alpha-COP encode the bioactive peptide, xenin, which stimulates exocrine pancreatic secretion and may act as a gastrointestinal hormone.

Molecular Weight: 135 kDa (MW of target protein)

Pathways: Hormone Activity